celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerbien-êtreboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Organic brioche bread

Elisabeth

Organic* brioche bread, crispy bacon, mimosa eggs, escarole, light vinaigrette

Ingredients

Organic brioche bread* 36% (WHEAT flour), crispy bacon 18% (pork fat, dextrose, glucose syrup, herbs, spices, flavourings (SOJA), antioxidants, preservatives, eggs mimosa 36% (egg, YOGHURT - CELERY vinaigrette (alcohol vinegar, water, potato, onion, salt, concentrated lemon juice, spices), parsley), escarole, light vinaigrette (rapeseed oil 40%, water, red wine vinegar, MUSTARD, salt, corn starch, pepper). *36 of the ingredients are from organic farming. Certified by Certisys BE-BIO-01

Allergens

  • Celery
  • Eggs
  • Gluten
  • Milk
  • Mustard

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 442kcal
    22%
  • Total fat 23g
    33%
  • Saturated fatty acids 6g
    28%
  • Glucid 31g
    12%
  • Sugar 7g
    8%
  • Protein 26g
    52%
  • Salt 2g
    35%
  • FA 2g
    6%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

For all tastes

Our dishes are mainly based on vegetables, of local origin and season, which are at the heart of our recipes. Quality meat or fish sometimes accompanies them, in order to offer a wide variety for all tastes. All our breads are organic and cooked fresh every day. Our chicken comes from responsible farming and we outlaw battery-raised eggs. Our cod comes from a certified sustainable fishing circuit. All of our dairy products are organic. Our coffee is organic and fair trade.