celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerbien-êtreboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Spring Rolls

Jounhi

Spring rolls with organic* mixed vegetables, sesame, fresh herbs

Ingredients

Raw mixed vegetables 41% (organic* beetroot, organic* carrot, orange juice, parsley, rapeseed oil, coriander 2%, SESAME), rice paper wraps 14%, yellow curry emulsion 14% (CELERIAC, MUSTARD), seasonal salad mix, coriander, fresh mint, sauce organic* Tamari (SOYA, orange juice). Certified by Certisys BE-BIO-01

Allergens

  • Celery
  • Mustard
  • Sesame
  • Soya

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 117kcal
    6%
  • Total fat 6g
    8%
  • Saturated fatty acids 1g
    3%
  • Glucid 12g
    5%
  • Sugar 6g
    6%
  • Protein 3g
    6%
  • Salt 2g
    39%
  • FA 3g
    11%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Vegetarian recipes

Our vegetarian dishes are prepared without meat or fish but may contain dairy, eggs, or traditional rennet cheeses. We use seasonal vegetables, grown locally, naturally rich in vitamins and nutrients. You find these recipes easily thanks to the light green "Veggie" pictogram.