celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-downfacebookinstagramtwitter200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoom
Our news

Des grains Fairtrade et Bio, un café réconfortant et chaud

1684. C’est le nombre de tasses de café bues chaque seconde dans le monde. Espresso, lungo, macchiato ou cappuccino ? Le café nous accompagne dès le saut du lit pour réveiller nos papilles et booster notre journée.

Cette boisson noire à l’odeur amère est devenue une icône chez EXKi. Et pour cause : cette petite tasse se boit seule ou se partage entre amis.

Cependant, même si cette boisson est la plus consommée dans le monde, les coulisses des productions de cafés sont parfois sombres. C’est pourquoi, depuis 2003, EXKi a décidé de servir un meilleur café. Meilleur pour le client, meilleur pour les caféiculteurs mais aussi meilleur pour la nature.

Venez découvrir ce qui se cache derrière votre petite tasse à carotte !

Le café, une affaire de famille !

Asseyez-vous à votre table avec votre café EXKi. Fermez les yeux et suivez du nez l’odeur du café fraîchement moulu : vous atterrirez… Chez Café Liégeois.

Café Liégeois, c’est une entreprise familiale, tenue par Michel et Benoît Liégeois. Passionnés depuis toujours par le bon café, ils sont en permanence à la recherche de qualité. Le dynamisme de leur entreprise surprend le marché : ils proposent des cafés des Grandes Origines, et commercialisent un café produit dans des conditions saines et naturelles. Et c’est surtout sur cet aspect environnemental qu’ils font la différence : ils sont engagés dans une démarche environnementale et le café est issu du commerce équitable. C’est d’ailleurs pour cela qu’il a remporté la licence Max Havelaar, une branche de l’organisation Fairtrade International garantissant un produit issu du commerce équitable.

C’est ce café qui a été choisi pour EXKi.

 

Des grains Fairtrade et Bio, un café réconfortant et chaud

Que se cache derrière ces mystérieuses appellations « Fairtrade » et « BIO » ? Nous allons vous en toucher deux mots.

Le café est devenu le produit agricole tropical le plus valorisé et le plus commercialisé autour du globe. Selon les chiffres de l’Organisation Internationale du Café (ICO), la production mondiale de café a atteint plus de 10.2 millions de tonnes en 2018. Ce café fait vivre plus de 125 millions de producteurs dans le monde, répartis dans 56 pays. Mais ces pays font face à des difficultés, notamment à cause du prix d’achat du café qui varie énormément.

Pour aider les producteurs locaux à produire en quantité suffisante pour subsister, des entités se sont développées. Elles permettent ainsi aux producteurs de centraliser leurs moyens de production et donc de réduire efficacement leurs coûts de productions. C’est pourquoi certaines coopératives ont vu le jour, notamment en Bolivie.

La Bolivie est seulement classée 30ème pays producteur de café alors qu’elle réunit d’excellentes conditions pour produire un café de qualité : un terrain montagneux et un climat chaud et humide. Malgré les conditions idéales pour produire du café, la production de café peine à grimper.

En fait, les producteurs de café boliviens font aujourd’hui face à une série d’obstacles qui empêche une production efficace et durable des grains de café : problèmes logistiques, manque d’investissement, changement climatiques, volatilité du prix du café…  Les producteurs se battent au quotidien contre les différents obstacles qui freinent leur production. Mais le principal nerf de la guerre, c’est la rémunération, que nous voulons juste pour nos producteurs. Une réponse efficace ? Le commerce équitable !

 

Comment EXKi soutient les producteurs boliviens ? En travaillant main dans la main !

C’est dans la région des Yungas en Bolivie que nos caféiculteurs cultivent le café à la verticale, sur une terre fertile, ce qui permet d’obtenir un café très fruité et de grande qualité.

Le café EXKi est labellisé Fairtrade et bio, ce qui signifie qu’il garantit le respect des règles strictes du commerce équitable avec les producteurs et la préservation de l’environnement.

Le commerce équitable, c’est un partenariat commercial qui se veut une alternative au commerce international traditionnel et dont l'objectif est de parvenir à un développement harmonieux et durable des producteurs défavorisés et marginalisés.

L’organisation Fairtrade International a pour objectif d’élaborer un label de commerce équitable. Ce label met en avant l’aspect écologique, grâce à un cahier des charges que les producteurs doivent respecter : traitement des déchets et des champs, interdiction d’utiliser des herbicides et la mise en avant d’une agriculture biologique. Les conditions de vie, de rémunération et de travail des différents producteurs est également garanti par ce label. Enfin, cela assure un prix minimum pour les producteurs, qui n’auront plus à s’inquiéter de la volatilité du prix du café.

Chez EXKi, voulons vous offrir du vrai, du bon. C’est pourquoi nous avons décidé de participer à cette coopérative, et nous mettons en lumière nos producteurs car nous souhaitons qu’ils travaillent dans des conditions adéquates. Pour nous, offrir un café bio et Fairtrade, c’est une réponse efficace et adéquate pour les producteurs et leur famille. C’est pourquoi, en 2004, nous avons décidé de nous approvisionner en café issu du commerce équitable. En achetant ce café, vous agrandissez le cercle des producteurs qui bénéficient de ce système.

En outre, EXKi soutient des projets dans les Yungas depuis 2012. Pour les années 2018 à 2022, EXKi finance le salaire sur place d’un ingénieur agronome via l’ONG SOS FAIM (sosfaim.com) ainsi qu’un Grand Prix, celui du meilleur projet de développement de l’agriculture vivrière locale (trois lauréats tous les deux ans).

Coffee team et Cafés Liégeois sont associés à ces projets avec EXKi depuis le début en 2012 : Johan Declercq (Fairtrade Label Organisation), Gregory Dupuis (Coffee Team), Nicolas Steisel (EXKi) et Michel Liégeois (Cafés Liégeois).

Depuis 2015, nous avons décidé de nous approvisionner en café bolivien, mais également de soutenir les producteurs de café venant du Mexique. i Ay Caramba ! En mélangeant ces deux cafés, nous obtenons un café aux arômes voyageurs et à la mousse rêveuse.

 

Et dans les restaurants, ça se passe comment ?

Un café convivial, un moment génial

Choisir les bons fournisseurs, c’est bien mais ça ne fait pas tout. En restaurant, le café, on le distribue bien torréfié, chaud comme il faut, aussi réconfortant qu’un feu de cheminée.

Tous les jours, nos équipiers se transforment en barista. Au choix : cappuccino, lungo, mais aussi un macchiato ou un simple espresso. Et avec ceci, une touche de folie ? Ajoutez du sirop, ou tentez le Belgoccino® !

 

Un café solidaire pour les plus solitaires

Et vous, votre café, vous le prenez comment ? Serré, allongé, noisette ou solidaire ?

Le café, un rituel pour certain, un luxe pour d’autres. Puisque tout le monde n’a pas la chance de s’offrir un café, EXKi vous propose de participer à une action solidaire.

Chaque année, nous organisons l’opération Share a Coffee. Le but ? Offrir des cafés aux plus démunis. Lors du passage en caisse, vous pouvez choisir d’ajouter un euro pour cette opération. Ce don sera reversé à nos associations partenaires La Mie de Pain et Opération Thermos afin qu’ils puissent offrir l’équivalent de la somme rassemblée en cafés aux sans-abris. L’an dernier, nous avions récolté l’équivalent de 286,325 cafés, soit plus d’un an de stock pour chaque association ! On aperçoit même les sourires se refléter dans les tasses.

L’objectif pour 2020 ? Battre le record !

Et ce n’est pas tout. Chez EXKi, le café, c’est indispensable. Et le marc de café, vous pensez que nous allions l’abandonner ?

Nous tenons à valoriser nos déchets. C’est pourquoi nous sommes partenaires avec Permafungi depuis sa création en 2014. Permafungi, c’est une organisation belge qui récupère notre marc de café pour en faire… Des pleurotes ! Les micro-éléments contenus dans le marc de café sont un substrat idéal pour la culture de ces champignons.

C’est pourquoi, chaque semaine, le marc de café utilisé dans 8 de nos restaurants bruxellois est récupéré à vélo ! Puisque dans la nature, les déchets n’existent pas : pourquoi pas s’en inspirer ?

Our news

Fairtrade en biobonen, troostende en warme koffie

1684. Dat is het aantal koppen koffie die elke dag wereldwijd gedronken worden. Espresso, lungo, macchiato of cappuccino? Er is koffie zodra we uit bed springen, koffie om een boost te geven aan onze dag.

Dit zwart drankje dat wat bitter geurt, is een echt icoon geworden bij EXKi. En met reden: dit kleine kopje is heerlijk om alleen van te genieten maar evengoed voor fijne momenten met vrienden.

Maar ook al is dit de meest geconsumeerde drank ter wereld, achter de schermen van de koffieproductie gaat het er soms minder fraai aan toe. Daarom besliste EXKi in 2003 om betere koffie te schenken. Beter voor de klant, beter voor de koffietelers, maar ook beter voor de natuur.

Kom ontdekken wat achter je kopje met de wortel zit!

Koffie, een familiezaak!

Neem plaats aan je tafel met je EXKi*koffie. Sluit de ogen en snuif de geur van versgemalen koffie op. Je belandt bij … Café Liégeois.

Café Liégeois is een familiebedrijf dat geleid wordt door Michel en Benoît Liégeois. Lekkere koffie is al van kindsbeen af hun grote passie in feite. Ze zijn dan ook voortdurend op zoek naar kwaliteit. Het dynamisme van hun bedrijf verrast de markt. Ze bieden 'Grandes Origines' koffie aan, m.a.w. de beste koffiesoorten ter wereld. Hun koffie wordt bovendien in gezonde en natuurlijke omstandigheden geproduceerd. Het is vooral in hun aanpak op het vlak van milieuzorg dat ze inderdaad het verschil maken. Ze werken uitsluitend milieuvriendelijk en hun koffie komt uit de eerlijke handel. Dat leverde het bedrijf trouwens de Max Havelaar-licentie op, een onderdeel van de organisatie Fairtrade International die garandeert dat een product beantwoordt aan de normen voor eerlijke handel.

Het is deze koffie die voor EXKi werd gekozen.

 

Fairtrade en biobonen, troostende en warme koffie

Wat gaat er nu precies schuil achter die raadselachtige benamingen 'Fairtrade' en 'BIO'? We geven een woordje of twee uitleg.

Koffie groeide uit tot het meest gewaardeerde en meest verkochte tropisch landbouwproduct op wereldschaal. Volgens de cijfers van de ICO (International Coffee Organisation - Internationale Koffieorganisatie) lag de wereldkoffieproductie in 2018 op meer dan 10,2 miljoen ton. Wereldwijd leven meer dan 125 miljoen producenten van koffie, gespreid over 56 landen. Maar deze landen kampen moet moeilijkheden, onder meer door de aankoopprijs van koffie die erg kan schommelen.

Om de lokale producenten te helpen voldoende te produceren om te overleven, werden entiteiten opgericht. Zo kunnen de producenten hun productiemiddelen centraliseren en dus hun productiekosten efficiënt drukken. Daarom zag een aantal coöperatieven het levenslicht, onder meer in Bolivia.

Bolivia staat pas op de 30ste plaats in de ranglijst van koffieproducerende landen, terwijl de omstandigheden voor de productie van een kwaliteitskoffie er toch uitstekend zijn: een bergachtig gebied en een warm en vochtig klimaat. Ondanks die ideale omstandigheden om koffie te telen, neemt de koffieproductie amper toe.

De reden is dat de Boliviaanse koffietelers vandaag het hoofd moeten bieden aan een hele reeks hinderpalen voor een efficiënte en duurzame productie van koffiebonen: logistieke problemen, een tekort aan investeringen, klimaatverandering, de schommelende koffieprijzen. De telers leveren elke dag strijd tegen al die aspecten die een rem zetten op hun productie. Maar waar het schoentje vooral wringt, is de vergoeding, die volgens ons billijk moet zijn voor onze producenten. Een doeltreffend antwoord? Eerlijke handel!

 

Hoe steunt EXKi de Boliviaanse producenten? Door hand in hand te werken!

Onze koffietelers in de regio van de Yungas in Bolivia telen de koffie verticaal, op een vruchtbare bodem, wat een zeer fruitige koffie van hoge kwaliteit oplevert.

De EXKi-koffie heeft het Fairtrade- en het biokeurmerk, wat betekent dat hij waarborgt dat de strenge regels van de eerlijke handel worden nageleefd bij de producenten en dat het milieu beschermd wordt.

Eerlijke handel is een commercieel partnerschap dat zich opwerpt als alternatief voor de traditionele internationale handel. Het doel is de harmonieuze en duurzame ontwikkeling van kansarme en achtergestelde producenten.

De organisatie Fairtrade International wil een keurmerk voor eerlijke handel uitwerken. Dit keurmerk legt de klemtoon op het milieuvriendelijk aspect, met een bestek dat de producenten moeten naleven: behandeling van het afval en van de velden, verbod op het gebruik van herbiciden en actieve toepassing van biologische landbouw. Dit label garandeert ook de levensomstandigheden en de vergoeding van de producenten. Tot slot staat het borg voor een minimale prijs voor de producenten, die zich dus geen zorgen meer moeten maken om de schommelingen in de koffieprijs.

Bij EXKi willen wij echte, goede producten aanbieden. Daarom beslisten we om mee te werken met deze coöperatieve. Wij richten de schijnwerpers op onze producenten omdat wij willen dat zij in gepaste omstandigheden kunnen werken. Voor is een biologische en fairtradekoffie aanbieden een efficiënt en passend antwoord aanbieden voor de producenten en hun gezinnen. Dat spoorde ons in 2004 aan om onze koffie af te nemen uit de eerlijke handel. Wie deze koffie koopt, vergroot de kring van producenten die partij trekken van dit systeem.

Daarnaast steunt EXKi sinds 2012 projecten in de Yungas. Voor de jaren 2018 tot 2022 financiert EXKi het loon van een landbouwkundig ingenieur ter plaatse, via de NGO SOS FAIM (sosfaim.com), en ook met een Grote Prijs voor het beste ontwikkelingsproject in de lokale zelfvoorzieningslandbouw (drie laureaten om de twee jaar).

Coffee Team en Café Liégeois sloten zich van bij de start in 2012 samen met EXKi aan bij deze projecten: Johan Declercq (Fairtrade Label Organisation), Gregory Dupuis (Coffee Team), Nicolas Steisel (EXKi) en Michel Liégeois (Café Liégeois).

In 2015 beslisten we om Boliviaanse koffie in te kopen en tegelijk ook om de koffietelers uit Mexico te steunen. i Ay Caramba! Uit de mengeling van deze twee koffies ontstond een koffie met aroma's die aan reizen doen denken, en met schuim dat doet dromen.

 

En wat gebeurt er in de restaurants?

Een gezellige koffie, een uitgelezen moment

De juiste leveranciers kiezen, dat is natuurlijk prima, maar het is niet alles. De koffie in ons restaurant wordt goed gebrand en warm geserveerd zoals het hoort, om net zo te troosten als een hardvuur.

Elke dag veranderen onze teamleden in volleerde barista's. Keuze genoeg: cappuccino, lungo, maar ook macchiato of gewone espresso. En mag het wat gekker? Doe er dan siroop bij of proef van een Belgoccino®!

 

Solidaire koffie voor wie het alleen moet rooien

En hoe wil jij je koffie graag? Sterk, lungo, met hazelnoot of solidair?

Voor sommigen is koffie een ritueel, voor anderen luxe. Omdat niet iedereen het geluk heeft om zich koffie te veroorloven, stelt EXKi je voor om mee te doen aan een solidaire actie.

Elk jaar organiseren wij de operatie Share a Coffee. Waarom? Om koffie te serveren aan de minstbedeelden. Aan de kassa kan je een euro laten bijrekenen voor deze campagne. Die gift gaat naar onze partners-verenigingen La Mie de Pain en Operatie Thermos, die met het bedrag koffie kopen om uit te delen aan daklozen. Vorig jaar zamelden we voldoende in voor 286.325 koffies, of meer dan een jaar voorraad voor elke vereniging! Soms lijkt het wel alsof de kopjes zelf glimlachen.

Het doel voor 2020? Het record breken!

En het is nog niet alles. Bij EXKi is koffie onmisbaar. We horen het jullie al denken, en wat met het koffiedik?

Wij passen ons afval maximaal nuttig toe. Daarom sloten wij sinds haar oprichting in 2014 een partnerschap met de Belgische organisatie Permafungi, die ons koffiedik verwerkt om ... oesterzwammen te kweken! De micro-elementen in koffie zijn dan ook een ideaal substraat voor de teelt van de paddenstoelen.

Daarom wordt het koffiedik van acht van onze Brusselse restaurants opgehaald met de fiets! In de natuur bestaat afval niet, als dat niet inspirerend is ...

Our news

Fairtrade and Organic beans, a hot, comforting coffee

1,684. That’s how many cups of coffee are drunk in the world every second. Espresso, lungo, macchiato or cappuccino? Coffee is part of our lives from the moment we get up in the morning to awaken our taste buds and boost our day.

This dark beverage with its bitter smell has become an icon at EXKi. And with good reason: it can be savoured alone or shared with friends.

However, even if this is the world's most popular drink, the situation behind the scenes in coffee production is sometimes grim. This is why, as of 2003, EXKi decided to serve better coffee. Better for the customer, better for the coffee growers, but also better for nature.

Come and find out what lies hidden behind your little cup with the carrot!

 

Coffee, a family affair!

Sit at your table with your EXKi coffee. Close your eyes and follow the fragrance of freshly ground coffee with your nose: you will find yourself… at Café Liégeois.

Café Liégeois is a family business run by Michel and Benoît Liégeois. They have always been passionate about good coffee and are constantly in search of quality. The market is surprised by the dynamism of their business surprises: they supply Grandes Origines coffees and market coffee produced in natural, healthy conditions. They stand out mainly as regards this environmental aspect: they adopt an environmental approach and their coffee comes from the fair trade sector. Indeed, this is why it was granted the Max Havelaar licence, a branch of the Fairtrade International organisation guaranteeing that products come from fair trade.

This is the coffee selected for EXKi.

Fairtrade and Organic beans, a hot, comforting coffee

What lies behind these mysterious ‘Fairtrade’ and ‘Organic’ titles? Let us tell you a little about them.

Coffee has become the most highly valued and widely marketed tropical agricultural product in the world. According to the figures from the International Coffee Organisation (ICO), world coffee production amounted to over 10.2 million tonnes in 2018. It provides a livelihood for over 125 million producers in 56 countries around the world. Nevertheless, these countries face difficulties, in particular because of the purchase price of coffee, which varies hugely.

To help local producers make sufficient quantities to be able to survive, entities have been created. These enable the coffee growers to centralise their production means and thereby reduce their production costs efficiently. This is why a number of cooperatives have been set up, in particular in Bolivia.

Bolivia ranks just 30th among the coffee-producing countries, even though it benefits from excellent conditions to produce high-quality coffee: a mountainous terrain and a warm, humid climate. Despite the ideal conditions, coffee production struggles to increase.

In fact, Bolivian coffee growers currently face a series of obstacles that prevent the efficient, lasting production of coffee beans: logistics problems, lack of investment, climate change, the volatility of the coffee price and more. Growers battle daily with the various hurdles that curb their production. But the crux of the matter is the remuneration, which we aim to be fair for our producers. An effective response? Fair trade!

How does EXKi support Bolivian producers? By working hand in hand with them!

Our producers grow coffee vertically in the Yungas region of Bolivia, on fertile soil that yields a very fruity, prime quality coffee.

EXKi coffee bears the Fairtrade and organic label, which means that it guarantees compliance with the stringent rules of fair trade with the producers and environmental conservation.

Fair trade is a commercial partnership set up to offer an alternative to traditional international trade with the objective of achieving harmonious, long-term development for underprivileged and marginalised producers.

The Fairtrade International organisation aims to develop a fair trade label. This label highlights the environmental aspect thanks to specifications which producers have to comply with: waste processing and the treatment of fields, ban on the use of herbicides and the promotion of organic farming. This label also guarantees the living, pay and working conditions of the various producers. Finally, it ensures a minimum price for producers, who will no longer have to worry about the volatility of the coffee price.

At EXKi, we aim to offer you a good, authentic product. Which is why we decided to take part in this cooperative. We turn the spotlight on our producers because we want them to be able to work in adequate conditions. We believe that offering organic Fairtrade coffee is an effective and adequate response for producers and their families. This is why in 2004 we decided to obtain our coffee supplies from the fair trade sector. By buying this coffee, you extend the circle of producers who benefit from this system.

What’s more, EXKi has been supporting projects in the Yungas region since 2012. For the period 2018 to 2022, EXKi is funding the salary of an agronomic engineer working on site via the NGO SOS FAIM (sosfaim.com), as well as the Grand Prix of the best development project in local subsistence farming (three prize winners every two years).

Coffee Team and Café Liégeois joined these projects alongside EXKi as of the start of 2012: Johan Declercq (Fairtrade Label Organisation), Gregory Dupuis (Coffee Team), Nicolas Steisel (EXKi) and Michel Liégeois (Café Liégeois).

As of 2015, we decided to obtain our coffee supplies from Bolivia, but also to support coffee producers from Mexico. ¡ Ay Caramba ! Blending these two types gives us a coffee with the fragrance of travel and a dreamy froth.

 

What happens in the restaurants?

Coffee with friends, a great time

Choosing the right suppliers is good, but it’s not everything. In the restaurants, the coffee served is roasted and hot, just as it should be, as comforting as an open fire.

Our team members become baristas every day. The range includes cappuccino and lungo but also macchiato or a simple espresso. And what about a touch of extravagance to go with it? Add syrup or try the Belgoccino®!

A mutually supportive coffee for the most solitary among us

And how do you take your coffee? Strong, long, nutty or mutually supportive?

Coffee is a ritual for some, a luxury for others. Since not everyone is fortunate enough to be able to afford a coffee, EXKi offers you the opportunity to take part in a mutually supportive action.

Every year, we organise the Share a Coffee campaign. The aim? To offer coffee to the most deprived. When you pay, you can opt to add one euro for this campaign. This donation will be passed on to our partner associations La Mie de Pain and Opération Thermos so that they can offer the equivalent of the amount collected to the homeless in coffees. Last year, we collected the equivalent of 286,325 coffees, which represents over a year’s stock for each association! You can even see the smiles reflected in the cups.

The target for 2020? To break the record!

And that’s not all. At EXKi, coffee is essential. What about the coffee grounds: do you think we just throw them out?

We make a point of reusing our waste. This is why we joined forces with Permafungi when it was established in 2014. Permafungi is a Belgian organisation that recovers our coffee grounds to make them into… oyster mushrooms! The micro-elements contained in coffee grounds provide an ideal substrate for growing these mushrooms.

And so every week the coffee grounds used in eight of our Brussels restaurants are recovered by bike! Because there’s no waste in nature, why not follow its example?

Our news

Onze groente van de maand: Rode biet

 

Groente van de maand, groente in de schijnwerpers ...

Voor jouw gezondheid en die van onze planeet zet EXKi elke maand een fruitsoort of groente in de schijnwerpers. De gelukkige winnaar wordt verwerkt in verschillende gerechten om je vingers bij af te likken. Ontdek ze hieronder!

Vandaag is rood de kleur van...risotto!

Meer nog, het is de kleur van het geheime ingrediënt in onze overheerlijke risotto, in alle geuren en vooral kleuren. Dit wordt een februarimaand als geen andere, geloof het maar. Frisjes buiten? Van onze risotto word je helemaal warm.

Als groente van de maand kan de rode biet je ook gewoon niet koud laten. Samen met Vita® kip wordt dit gerecht een echte topper.

 

Risotto met rode biet, wortel en kip

Bereiding: 15 min + gaartijd: 22 min

Makkelijk

Ingrediënten voor 4 personen:

  • 300 tot 350 g rode bieten (1 dikke of 2 tot 3 kleine)
  • 250 g fijne wortelen
  • 160 g erwtjes (diepvries)
  • 1 ui
  • 1 kipfilet
  • 200 g arboriorijst
  • 2 blokjes gevogeltebouillon
  • 3 el olijfolie
  • 20 g boter
  • 4 takjes basilicum
  • Zout en peper

Bereiding:

  1. Schil de bieten en rasp ze. Schil de wortelen en snij ze in fijne schijfjes. Hak de ui fijn.
  2. Snij de kip in blokjes en bak ze op hoog vuur even aan in een grote pan met olijfolie. Verwijder ze met een schuimspaan als ze mooi goudbruin zijn.
  3. Bak dan in dezelfde pan de gehakte ui 2 min op zacht vuur. Doe er de biet bij, meng 1 min en voeg dan de rijst toe. Laat 2 min bakken en giet er vervolgens 7 dl warme bouillon bij (water + blokjes) bij. Doe er de wortelen bij. Breng aan de kook en laat 18 min sudderen op zacht vuur.
  4. Haal van het vuur, doe er de boter, de erwtjes en de kippenblokjes bij. Laat 2 min rusten, meng en kruid bij. Dien meteen op, versierd met basilicum.

Tip: u kan 1/4 bouillon vervangen door witte wijn.

Our news

Veggie of the month, veggie in the spotlight: the beetroot

Veggie of the month, veggie in the spotlight ...

For our health, and that of our planet, we put a fruit or seasonal vegetable in the spotlight every month. The lucky winner is featured in several delicious recipes. Discover them here!

A risotto to put colour in your cheeks

In February, it’s time to warm up! What could be better than a yummy risotto to stay snug? And we’ve found the secret ingredient for a dazzling, delicious twist on this traditional recipe: beetroot!

Accompanied by Vita®-certified chicken in this hot dish, it’s a taste sensation. This brightly coloured vegetable of the month continues to cause a stir!

 

Preparation time: 15 min. + cooking time: 22 min.

Easy

 

Serves 4:

  • 300 to 350 g beetroot (1 large or 2 to 3 small)
  • 250 g thin carrots
  • 160 g peas (frozen)
  • 1 onion
  • 1 chicken fillet
  • 200 g arborio rice
  • 2 cubes chicken stock
  • 3 tbsp. olive oil
  • 20 g butter
  • 4 sprigs basil
  • salt and pepper

 

Method:

  1. Peel and grate the beetroot. Peel the carrots and cut into thin slices. Chop the onion finely.
  2. Dice the chicken and brown over a high heat in a large frying pan with olive oil. Remove using a slotted spoon when nice and golden.
  3. Put the onion in the same pan and brown over a gentle heat for 2 mins. Add the beetroot, mix for one 1 min., then add the rice. Brown for 2 mins, then pour in 7 dl of hot stock (water + cubes) and the carrots. Bring to the boil, cover and leave to simmer over a gentle heat for 18 mins.
  4. Remove from the heat, then add the butter, peas and diced chicken. Leave to rest for 2 mins; mix and season to taste. Serve immediately, garnished with basil.

Tip: You can replace ¼ of the stock with white wine.

Our news

Légume du mois, légume d'émoi : La betterave

 

Légume du mois, légume d'émoi...

Pour notre santé et celle de notre planète, nous mettons chaque mois un fruit ou un légume de saison à l’honneur. L’heureux élu est décliné en plusieurs recettes gourmandes. Pour les découvrir, c’est par ici !

Le risotto qui va vous faire rougir 

En février : il faut se réchauffer ! Et pour cela, rien de mieux qu’un délicieux risotto pour vous tenir chaud. Un risotto banal ? Pas rigolo. Nous avons trouvé l’ingrédient mystère pour le rendre beau.

La betterave va vous en faire voir de toutes les couleurs. Accompagnée par le poulet labellisé Vita® dans ce plat chaud, c’est un franc succès. Ce légume du mois n’a pas fini de vous mettre en émoi !

Risotto à la betterave, carottes et poulet

 

Préparation : 15 min + cuisson : 22 min

Facile

 

Ingrédients pour 4 personnes :

  • 300 à 350 g de betteraves (1 grosse ou 2 à 3 petites)
  • 250 g de fines carottes
  • 160 g de petits pois (surgelés)
  • 1 oignon
  • 1 filet de poulet
  • 200 g de riz arborio
  • 2 cubes de bouillon de volaille
  • 3 c à s d’huile d’olive
  • 20 g de beurre
  • 4 brins de basilic
  • Sel et poivre

 

Préparation :

  1. Pelez les betterave et râpez-les. Pelez les carottes et taillez-les en fines rondelles. Hachez finement l’oignon.
  2. Taillez le poulet en petits dés et faites-les revenir à feu vif dans une grande sauteuse contenant l’huile d’olive. Retirez-les avec une écumoire quand ils sont bien dorés.
  3. À leur place, faites revenir l’oignon haché 2 min à feu doux. Ajoutez la betterave, mélangez 1 min, puis ajoutez le riz. Faites revenir 2 min, puis versez 7 dl de bouillon chaud (eau + cubes) et les carottes. Portez à ébullition, couvrez et laissez mijoter 18 min à feu doux.
  4. Retirez du feu, puis ajoutez le beurre, les petits pois et les dés de poulet. Laissez reposer 2 min ; mélangez et rectifiez l’assaisonnement. Servez sans attendre, décoré de basilic.

Astuce : vous pouvez remplacer ¼ du bouillon par du vin blanc.

 

Our news

Cutlery

 

A twist of a fork for our planet

 

At EXKi, cutlery is a no small matter. And whether it’s made from plastic, stainless steel, or even from potatoes; we want to help you see things more clearly...

 

EXKi and planet-friendly cutlery: our story
 

At EXKi, nature is at the heart of everything we do, not just the food on our plates. We are constantly looking for ways to reduce the environmental impact of our packaging. This is how our #LessWasteTogether scheme came about, with the aim of seeking more eco-friendly packaging solutions. Every day, we pool our ideas and make the most of them to find sustainable solutions.

Cutlery is a key component of fast food. But should it be disposable or reusable? Well, that’s a story in itself...

 

At first, EXKi used wooden cutlery, naturally.

 

Since our first EXKi restaurant opened in 2001, we have been committed to offering eco-friendly and practical solutions for our customers. So we were one of the first to offer wooden cutlery to our customers.

Sadly, it was perhaps early days for this option. The products available on the market were not yet ideal and did not meet your expectations. This is why we decided to start using plastic cutlery instead.

 

What happened next? Brand new alternatives!

 

In 2007, we decided to start using an unexpected material: potato starch. This new cutlery was made from PLA: Polylactic Acid, derived from potato starch. In theory, this alternative seemed ideal. It met our environmental standards and seemed to satisfy our customers. But in hindsight, and based on the independent studies we carried out with CO2logic[XX1]  (a carbon offsetting label), we realised that the arguments put forward by the manufacturers of PLA cutlery do not stand up to scrutiny. The energy used to extract and produce this cutlery is in fact very carbon intensive. In addition, the material can only be composted on an industrial scale, within a biomethanisation plant. Since neither the restaurant nor the customer could guarantee that this cutlery would fully biodegrade, its environmental benefit was obsolete. Upstream, PLA is hardly carbon-neutral, while downstream its recycling process (into methane) is also very energy-intensive. So we decided to abandon this idea and go back to plastic.


In 2016, we reconsidered the idea of using polystyrene again, in its most lightweight form, to reduce our environmental impact. We have been awarded the ‘Carbon Neutral’ label from CO2logic, certifying that we offset our CO2 emissions. But we still wanted an all-natural solution. This is why in 2019 we decided to return to our original idea, offering FSC-certified (Forest Stewardship Council – an environmental label that aims to ensure sustainable forest management) wooden cutlery in our restaurants. Manufacturers have made great progress in recent years, and now offer us much more satisfactory solutions in terms of texture and taste.

 

What is EXKi doing today?

 

Through our #LessWasteTogether scheme, which aims to reduce our everyday waste and promote planet-friendly packaging, we have decided to opt for a more sustainable solution.

From now on, stainless steel cutlery will be available for our customers in our restaurants. We believe the best way to reduce our waste is not to create any. Offering reusable cutlery means limiting our environmental impact.

FSC©-certified wooden cutlery is still available for customers buying food to takeaway.

But that's not all! Our stainless steel cutlery is also available for sale at just 1 euro for an entire set!

What’s more, at EXKi, we reward each eco-friendly action: you can bring your own bags, cutlery, mugs and cups to our restaurants... By doing so, you earn points on your Green Card https://www.exki.be/fr/la-green-card 
 

And just like that, with a twist of a fork, we can help our planet!

 

Our news

Openingsuren van onze restaurants - 11 November

 

 

Hier zijn de openingstijden voor 11 november 2019. 

Restaurants die hieronder niet zijn weergegeven hebben dezelfde openingstijden als normaal gesproken:

 

BELGIUM :

EXKi Agora 8h-22h

EXKi Zaventem 4h-20h

EXKi Université 8h-17h

EXKi Westland Closed

EXKi Bourse 8h-22h

EXKi Madou Closed

EXKi Arts-Loi 7h - 16h30 - UITZONDERLIJK OPEN 

EXKi Berlaymont 7h - 16h30 - UITZONDERLIJK OPEN

EXKi Blue Tower Closed

EXKi Porte de Namur 9h-20h

EXKi Stephanie : 11h-18h

EXKi Schuman : 09h-18h

EXKi Rue Neuve : Closed 

EXKi Rue des Tongres : Closed

EXKi Woluwe : Closed

EXKi Froissart : Closed

EXKi Place du Luxembourg :Closed

EXKi Otan : Closed

EXKi Fonsny : Closed

EXKi Tournai : Closed

EXKi LLN 1 : Closed

EXKi LLN 2 : Closed

EXKi Charleroi Ville 2 : Closed

EXKi Wavre : Closed

EXKi LLN 1 : Closed

EXKi Liège : Closed

EXKi Namur : Closed

EXKi Charleroi : Closed

EXKi Mediacité : Closed

EXKi Belle-Ile : Closed

EXKi Nivelles : Closed

EXKi Ravenstein : Closed

EXKi Leuven : 09h-18h

EXKi Wavre Nord : Closed

EXKi Gent : 08h - 18h

 

FRANCE :

EXKi Boétie : Closed

EXKi Beaugrenelle 11h - 19h30

EXKi Tour Ariane : Closed

EXKi Pierre Mendès : Closed

EXKi Lyon République : 10h00 - 18h00

EXKi  Gare de Lyon-Part-Dieu : 8h00 - 21h00

EXKi Boulogne Billancourt : Closed

EXKi Rambuteau : 9h00 – 21h30

EXKi Batignolles : Closed

EXKi Italiens : 10h - 17h00

EXKi Avenue de France : 10h00 – 21h30

EXKi Montparnasse : 09h00 – 22h00

EXKi Berri : Closed

EXKi Antin : 11h30 – 18h00

EXKi Kléber : 11h00 – 17h00

EXKi Montorgueil : 10h00 – 21h30

EXKi Bercy : 11h30 – 18h00

EXKi Arche : Closed

EXKi Val d’Europe : 09h00 – 20h30

EXKi Saint-Lazare : 10h00 – 19h00

Our news

Horaires exceptionnels - 11 novembre

Our news

Onze groente van de maand: venkel

Groente van de maand, groente in de schijnwerpers ...

Voor jouw gezondheid en die van onze planeet zet EXKi elke maand een fruitsoort of groente in de schijnwerpers. De gelukkige winnaar wordt verwerkt in verschillende gerechten om je vingers bij af te likken. Ontdek ze hieronder!

Het regent, het is nat, en de venkel komt tevoorschijn. Het bewijs: de groente zit verwerkt in ons recept van deze maand.

Venkel is onze ster van de maand november en heeft meerdere superkrachten: doordrenkt met mineralen, boordevol vitaminen en rijk aan micronutriënten. Perfect om de winter mee te beginnen.Wij hebben de venkel uitgenodigd op onze borden, samen met MSC-kabeljauw en courgette.

Zin om het recept te ontdekken?

 

Compote van venkel met sinaasappel, kabeljauw en krokante courgettes

Bereiding: 35 min

Makkelijk

Ingrediënten voor 4 personen:

  • 2 kleine venkels
  • 2 kleine courgettes
  • 1 sinaasappel
  • 1 citroen
  • 1 ui
  • 400 g kabeljauwrug
  • 4 el olijfolie
  • 4 takjes platte peterselie
  • ½ kl venkelzaadjes
  • zout en peper

 

Bereiding:

  1. Verwijder de venkeltakjes (bewaar het groen) en snij de knollen in blokjes. Hak de ui. Stoof  alles 2 min. lang op een zacht vuurtje in een grote stoofpan, met 2 el olijfolie en de venkelzaadjes. Doe er het sinaasappelsap bij en breng op smaak met peper en zout. Laat 10 min. afgedekt sudderen op een zacht vuurtje, en nog eens 10 min. zonder deksel.  
  2. Snij de courgettes in blokjes en stoof ze 5 min. op een goed vuurtje, in een pan met 2 el olijfolie. Doe er de gehakte peterselie, zout en peper bij.  
  3. Snij de kabeljauw in vier en leg de stukken op de venkel, dek af en laat 5 min. garen op een zacht vuurtje. Breng op smaak met zout en peper.
  4. Dien de kabeljauw op met de venkelcompote en de courgettes. Versier met toefjes venkel en een citroenpartje. Maak af met aardappelpuree.  

 

Kneepje: vervang de kabeljauw eens door stukjes 

Seiten

Exki.com RSS abonnieren Exki.com RSS abonnieren